PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012282P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 422aa    MW: 48098.9 Da    PI: 6.1475
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012282P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like63.15.5e-20120173155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k r++W+++LH++F ea+++L G+ k  Pk il++m+ ++Ltl +v+SHLQk+++
  MELO3C012282P1 120 KSRIVWNSKLHRKFTEALSKL-GNRKSSPKIILKMMDEPSLTLRQVASHLQKFKS 173
                     68*******************.9******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-19118177IPR009057Homeodomain-like
SuperFamilySSF466892.78E-13118176IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-17120173IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MSLEMDMKTA GRAIAEWGCY FLEKPISMED IELVWQIVYR KVRNPRAKSL GENTKLGKRS  60
EIDGMLGRIV NVTREVEWKP LEEEEKGGNG GKCRDQGEEK LNPLVKVEEK TNRNERTNKK  120
SRIVWNSKLH RKFTEALSKL GNRKSSPKII LKMMDEPSLT LRQVASHLQK FKSQVKHLNK  180
ITANDSSPST SFVKNQLQQL PPKRNTNILT QQISYITDHN LRHSQVPAAS CLNNPPTQLP  240
NSQDVFSPHL IMMNQNNSSN SYRTTQYRTT NNDLQLKTYG GLFEEMNLNL VEGNHVFTDE  300
LYTNESTLEG FIQTSHYSSS NFQHFPADED YYCSFFQDDH GQLEFAQNLA GSCLDVDNNI  360
ITSMSGAHSA VIAGRSMNQN VALKELDDLL NNTEEDPMVY CCYDGEMNSF DIDQYSEWLN  420
A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008447014.10.0PREDICTED: two-component response regulator ARR14-like
TrEMBLA0A0A0KR710.0A0A0A0KR71_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2482233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.17e-16response regulator 2